Keratin 10 anticorps

N° du produit ABIN630798

Détail du produit anti-Keratin 10 anticorps

Antigène: Keratin 10 (KRT10)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Keratin 10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Cytokeratin 10 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 10 Blocking Peptide, catalog no. 33R-2526, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Keratin 10

Antigène: Keratin 10 (KRT10)

Autre désignation: Cytokeratin 10 (KRT10 Produits)

Synonymes: anticorps BCIE, anticorps BIE, anticorps CK10, anticorps EHK, anticorps K10, anticorps KPP, anticorps D130054E02Rik, anticorps K1C1, anticorps Krt-1.10, anticorps Krt1-10, anticorps Ka10, anticorps Ker10, anticorps KRT10, anticorps KRT25, anticorps KRT27, anticorps KRT28, anticorps keratin 10, anticorps keratin 10, type I S homeolog, anticorps keratin, type I cytoskeletal 25, anticorps KRT10, anticorps Krt10, anticorps krt10.S, anticorps LOC101085587

Sujet: KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis.

Poids moléculaire: 59 kDa (MW of target protein)