TSPAN1 anticorps (Middle Region)

N° du produit ABIN630803

Détail du produit anti-TSPAN1 anticorps

Antigène: TSPAN1 (Tetraspanin 1 (TSPAN1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPAN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 1 antibody was raised against the middle region of TSPAN1

Purification: Affinity purified

Immunogène: Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 1 Blocking Peptide, catalog no. 33R-9202, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPAN1

Antigène: TSPAN1 (Tetraspanin 1 (TSPAN1))

Autre désignation: Tetraspanin 1 (TSPAN1 Produits)

Synonymes: anticorps TSPAN1, anticorps 9030418M05Rik, anticorps NET1, anticorps TM4C, anticorps TM4SF, anticorps tetraspanin 1, anticorps tetraspanin 1 L homeolog, anticorps TSPAN1, anticorps tspan1.L, anticorps Tspan1

Sujet: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Poids moléculaire: 26 kDa (MW of target protein)