NARG1L anticorps (Middle Region)

N° du produit ABIN630806

Détail du produit anti-NARG1L anticorps

Antigène: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NARG1L est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: NARG1 L antibody was raised against the middle region of NARG1

Purification: Affinity purified

Immunogène: NARG1 L antibody was raised using the middle region of NARG1 corresponding to a region with amino acids ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NARG1L Blocking Peptide, catalog no. 33R-1516, is also available for use as a blocking control in assays to test for specificity of this NARG1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NARG1L

Antigène: NARG1L (NAA16) (N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16))

Autre désignation: NARG1L (NAA16 Produits)

Synonymes: anticorps NARG1L, anticorps 1300019C06Rik, anticorps Narg1l, anticorps narg1, anticorps narg1l, anticorps N(alpha)-acetyltransferase 16, NatA auxiliary subunit, anticorps N(alpha)-acetyltransferase 16, NatA auxiliary subunit L homeolog, anticorps N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog, anticorps NAA16, anticorps Naa16, anticorps naa16.L, anticorps naa15.S

Sujet: NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

Poids moléculaire: 50 kDa (MW of target protein)