PRKX anticorps (N-Term)

N° du produit ABIN630810

Détail du produit anti-PRKX anticorps

Antigène: PRKX (Protein Kinase, X-Linked (PRKX))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKX est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKX antibody was raised against the N terminal of PRKX

Purification: Affinity purified

Immunogène: PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKX Blocking Peptide, catalog no. 33R-5894, is also available for use as a blocking control in assays to test for specificity of this PRKX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKX

Antigène: PRKX (Protein Kinase, X-Linked (PRKX))

Autre désignation: PRKX (PRKX Produits)

Synonymes: anticorps PKX1, anticorps Pkare, anticorps protein kinase, X-linked, anticorps PRKX, anticorps Prkx

Sujet: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis