Dnmt2 anticorps (N-Term)

N° du produit ABIN630813

Détail du produit anti-Dnmt2 anticorps

Antigène: Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Dnmt2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRDMT1 antibody was raised against the N terminal of TRDMT1

Purification: Affinity purified

Immunogène: TRDMT1 antibody was raised using the N terminal of TRDMT1 corresponding to a region with amino acids MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRDMT1 Blocking Peptide, catalog no. 33R-6114, is also available for use as a blocking control in assays to test for specificity of this TRDMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRDMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Dnmt2

Antigène: Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))

Autre désignation: TRDMT1 (TRDMT1 Produits)

Synonymes: anticorps MGC89267, anticorps DMNT2, anticorps DNMT2, anticorps MHSAIIP, anticorps PUMET, anticorps RNMT1, anticorps Dnmt2, anticorps Rnmt2, anticorps dnmt2, anticorps tRNA aspartic acid methyltransferase 1, anticorps tRNA aspartic acid methyltransferase 1 L homeolog, anticorps trdmt1, anticorps TRDMT1, anticorps Trdmt1, anticorps trdmt1.L

Sujet: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity.

Poids moléculaire: 44 kDa (MW of target protein)