LGALS8 anticorps

N° du produit ABIN630814

Cet anticorps Lapin Polyclonal détecte spécifiquement LGALS8 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour LGALS8 anticorps (ABIN630814)

Antigène: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGALS8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LGALS8 anticorps

Purification: Affinity purified

Immunogène: LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LGALS8 Blocking Peptide, (ABIN938400), is also available for use as a blocking control in assays to test for specificity of this LGALS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LGALS8

Antigène: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Autre désignation: LGALS8

Sujet: LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.

Poids moléculaire: 39 kDa (MW of target protein)