LGALS8 anticorps

N° du produit ABIN630814

Détail du produit anti-LGALS8 anticorps

Antigène: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGALS8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LGALS8 Blocking Peptide, catalog no. 33R-3014, is also available for use as a blocking control in assays to test for specificity of this LGALS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LGALS8

Antigène: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Autre désignation: LGALS8 (LGALS8 Produits)

Synonymes: anticorps LGALS8, anticorps 1200015E08Rik, anticorps AI326142, anticorps D13Ertd524e, anticorps Lgals-8, anticorps galectin-8, anticorps Gal-8, anticorps PCTA-1, anticorps PCTA1, anticorps Po66-CBP, anticorps xgalectin-VIIIa, anticorps galectin 8, anticorps lectin, galactose binding, soluble 8, anticorps lectin, galactoside binding soluble 8 S homeolog, anticorps LGALS8, anticorps Lgals8, anticorps lgals8.S

Sujet: LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.

Poids moléculaire: 39 kDa (MW of target protein)