Myoglobin anticorps (N-Term)

N° du produit ABIN630815

L’anticorps Lapin Polyclonal anti-Myoglobin a été validé pour WB. Il convient pour détecter Myoglobin dans des échantillons de Humain. Il y a 1 publication disponible.

Aperçu rapide pour Myoglobin anticorps (N-Term) (ABIN630815)

Antigène: Myoglobin (MB)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Myoglobin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Myoglobin anticorps

Épitope: N-Term

Specificité: Myoglobin antibody was raised against the N terminal of MB

Purification: Affinity purified

Immunogène: Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Myoglobin Blocking Peptide, (ABIN5614898), is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MB antibody in PBS

Concentration: Lot specific

Buffer: PBS, 0.09% sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-Myoglobin (ABIN630815)

Bell, Wilding, Funke, Perumal, Beck, Wolters, Holz-Müller, Pfeiffer, Grus: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." dans: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).

Détails sur Myoglobin

Antigène: Myoglobin (MB)

Autre désignation: Myoglobin

Sujet: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation