Myoglobin anticorps (N-Term)

N° du produit ABIN630815

Détail du produit anti-Myoglobin anticorps

Antigène: Myoglobin (MB)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Myoglobin est non-conjugé

Application: Western Blotting (WB)

Specificité: Myoglobin antibody was raised against the N terminal of MB

Purification: Affinity purified

Immunogène: Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Myoglobin Blocking Peptide, catalog no. 33R-6045, is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MB antibody in PBS

Concentration: Lot specific

Buffer: PBS, 0.09% sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-Myoglobin (ABIN630815)

Bell, Wilding, Funke, Perumal, Beck, Wolters, Holz-Müller, Pfeiffer, Grus: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." dans: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).

Détails sur Myoglobin

Antigène: Myoglobin (MB)

Autre désignation: Myoglobin (MB Produits)

Synonymes: anticorps PVALB, anticorps AI325109, anticorps zgc:65819, anticorps zgc:77764, anticorps MB, anticorps DKFZp468H096, anticorps myg, anticorps mb, anticorps MYF4, anticorps bHLHc3, anticorps myo, anticorps Myoglobin, anticorps myoglobin, anticorps myogenin, anticorps MB, anticorps Mb, anticorps mb, anticorps myg, anticorps Myog

Sujet: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation