MATN2 anticorps (Middle Region)

N° du produit ABIN630823

Cet anticorps Lapin Polyclonal détecte spécifiquement MATN2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour MATN2 anticorps (Middle Region) (ABIN630823)

Antigène: MATN2 (Matrilin 2 (MATN2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MATN2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MATN2 anticorps

Épitope: Middle Region

Specificité: Matrilin 2 antibody was raised against the middle region of MATN2

Purification: Affinity purified

Immunogène: Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Matrilin 2 Blocking Peptide, (ABIN936984), is also available for use as a blocking control in assays to test for specificity of this Matrilin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MATN2

Antigène: MATN2 (Matrilin 2 (MATN2))

Autre désignation: Matrilin 2

Sujet: MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.

Poids moléculaire: 102 kDa (MW of target protein)