MATN2 anticorps (Middle Region)

N° du produit ABIN630823

Détail du produit anti-MATN2 anticorps

Antigène: MATN2 (Matrilin 2 (MATN2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MATN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Matrilin 2 antibody was raised against the middle region of MATN2

Purification: Affinity purified

Immunogène: Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Matrilin 2 Blocking Peptide, catalog no. 33R-1598, is also available for use as a blocking control in assays to test for specificity of this Matrilin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MATN2

Antigène: MATN2 (Matrilin 2 (MATN2))

Autre désignation: Matrilin 2 (MATN2 Produits)

Synonymes: anticorps matn2, anticorps MGC53027, anticorps MGC76198, anticorps MATN2, anticorps DKFZp469F2020, anticorps Crtm2, anticorps matrilin-2, anticorps matrilin 2 L homeolog, anticorps matrilin 2, anticorps matn2.L, anticorps matn2, anticorps MATN2, anticorps Matn2

Sujet: MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.

Poids moléculaire: 102 kDa (MW of target protein)