Transglutaminase 5 anticorps (C-Term)

N° du produit ABIN630837

Cet anticorps anti-Transglutaminase 5 Polyclonal Lapin (ABIN630837) détecte spécifiquement Transglutaminase 5 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Transglutaminase 5 anticorps (C-Term) (ABIN630837)

Antigène: Transglutaminase 5 (TGM5)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Transglutaminase 5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Transglutaminase 5 anticorps

Épitope: C-Term

Specificité: Transglutaminase 5 antibody was raised against the C terminal of TGM5

Purification: Affinity purified

Immunogène: Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Transglutaminase 5 Blocking Peptide, (ABIN5616760), is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Transglutaminase 5

Antigène: Transglutaminase 5 (TGM5)

Autre désignation: Transglutaminase 5

Sujet: TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).

Poids moléculaire: 81 kDa (MW of target protein)