Cytokeratin 13 anticorps (N-Term)

N° du produit ABIN630838

Cet anticorps Lapin Polyclonal détecte spécifiquement Cytokeratin 13 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Cytokeratin 13 anticorps (N-Term) (ABIN630838)

Antigène: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytokeratin 13 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Cytokeratin 13 anticorps

Épitope: N-Term

Specificité: Cytokeratin 13 antibody was raised against the N terminal of KRT13

Purification: Affinity purified

Immunogène: Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 13 Blocking Peptide, (ABIN5613103), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytokeratin 13

Antigène: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Autre désignation: Cytokeratin 13

Sujet: KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.

Poids moléculaire: 46 kDa (MW of target protein)