MPDZ anticorps (Middle Region)

N° du produit ABIN630839

Détail du produit anti-MPDZ anticorps

Antigène: MPDZ (Multiple PDZ Domain Protein (MPDZ))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPDZ est non-conjugé

Application: Western Blotting (WB)

Specificité: MPDZ antibody was raised against the middle region of MPDZ

Purification: Affinity purified

Immunogène: MPDZ antibody was raised using the middle region of MPDZ corresponding to a region with amino acids DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPDZ Blocking Peptide, catalog no. 33R-1891, is also available for use as a blocking control in assays to test for specificity of this MPDZ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPDZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPDZ

Antigène: MPDZ (Multiple PDZ Domain Protein (MPDZ))

Autre désignation: MPDZ (MPDZ Produits)

Synonymes: anticorps HYC2, anticorps MUPP1, anticorps AI225843, anticorps B930003D11Rik, anticorps multiple PDZ domain crumbs cell polarity complex component, anticorps multiple PDZ domain protein, anticorps Multiple PDZ domain protein, anticorps inactivation-no-after-potential D protein, anticorps multiple pdz domain protein, putative, anticorps MPDZ, anticorps Mpdz, anticorps mpz-1, anticorps LOC5569990, anticorps Smp_168960

Sujet: MPDZ Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). It is a member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.

Poids moléculaire: 218 kDa (MW of target protein)

Pathways: Synaptic Membrane, Phototransduction