UBR7 anticorps (N-Term)

N° du produit ABIN630845

L’anticorps Lapin Polyclonal anti-UBR7 a été validé pour WB. Il convient pour détecter UBR7 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour UBR7 anticorps (N-Term) (ABIN630845)

Antigène: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBR7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBR7 anticorps

Épitope: N-Term

Specificité: C14 ORF130 antibody was raised against the N terminal Of C14 rf130

Purification: Affinity purified

Immunogène: C14 ORF130 antibody was raised using the N terminal Of C14 rf130 corresponding to a region with amino acids MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF130 Blocking Peptide, (ABIN5612407), is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBR7

Antigène: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Autre désignation: C14ORF130

Sujet: C14ORF130 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. C14ORF130 recognises and binds to proteins bearing specific amino-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

Poids moléculaire: 48 kDa (MW of target protein)