SPNS2 anticorps

N° du produit ABIN630851

L’anticorps Lapin Polyclonal anti-SPNS2 a été validé pour WB. Il convient pour détecter SPNS2 dans des échantillons de Humain.

Aperçu rapide pour SPNS2 anticorps (ABIN630851)

Antigène: SPNS2 (Spinster Homolog 2 (SPNS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPNS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SPNS2 anticorps

Purification: Affinity purified

Immunogène: SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPNS2 Blocking Peptide, (ABIN5616374), is also available for use as a blocking control in assays to test for specificity of this SPNS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPNS2

Antigène: SPNS2 (Spinster Homolog 2 (SPNS2))

Autre désignation: SPNS2

Sujet: SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Poids moléculaire: 60 kDa (MW of target protein)