GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) anticorps

N° du produit ABIN630853

Détail du produit

Antigène: GC-Rich Promoter Binding Protein 1 (GPBP1)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: DKFZP761 C169 antibody was raised against the N terminal Of Dkfzp761 169

Purification: Affinity purified

Immunogène: DKFZP761 C169 antibody was raised using the N terminal Of Dkfzp761 169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DKFZP761C169 Blocking Peptide, catalog no. 33R-7991, is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP760 169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: GC-Rich Promoter Binding Protein 1 (GPBP1)

Abstract: GPBP1 Produits

Synonymes: anticorps MGC80437, anticorps Vasculin, anticorps DKFZp459A203, anticorps GPBP, anticorps SSH6, anticorps VASCULIN, anticorps 1700034P14Rik, anticorps AU019836, anticorps D230035M11Rik, anticorps Gpbp, anticorps mGPBP, anticorps RGD1305492, anticorps GC-rich promoter binding protein 1 L homeolog, anticorps GC-rich promoter binding protein 1, anticorps gpbp1.L, anticorps gpbp1, anticorps GPBP1, anticorps Gpbp1

Sujet: Vasculin is a novel vascular protein differentially expressed in human atherogenesis.

Poids moléculaire: 52 kDa (MW of target protein)