NP (Middle Region) anticorps

N° du produit ABIN630859

Cet anticorps Lapin Polyclonal détecte spécifiquement dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour NP (Middle Region) anticorps (ABIN630859)

Antigène: NP

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: Middle Region

Specificité: NP antibody was raised against the middle region of NP

Purification: Affinity purified

Immunogène: NP antibody was raised using the middle region of NP corresponding to a region with amino acids GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NP Blocking Peptide, (ABIN939017), is also available for use as a blocking control in assays to test for specificity of this NP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: NP

Classe de substances: Viral Protein

Sujet: Defects in NP are the cause of nucleoside phosphorylase deficiency (NP deficiency). It leads to a severe T-cell immunodeficiency with neurologic disorder in children. The specific function of NP is not yet known.

Poids moléculaire: 32 kDa (MW of target protein)