PHACTR3 anticorps (C-Term)

N° du produit ABIN630871

Cet anticorps Lapin Polyclonal détecte spécifiquement PHACTR3 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour PHACTR3 anticorps (C-Term) (ABIN630871)

Antigène: PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHACTR3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PHACTR3 anticorps

Épitope: C-Term

Specificité: PHACTR3 antibody was raised against the C terminal of PHACTR3

Purification: Affinity purified

Immunogène: PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PHACTR3 Blocking Peptide, (ABIN939333), is also available for use as a blocking control in assays to test for specificity of this PHACTR3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACTR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHACTR3

Antigène: PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))

Autre désignation: PHACTR3

Sujet: PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.

Poids moléculaire: 51 kDa (MW of target protein)