GLE1 anticorps

N° du produit ABIN630876

Cet anticorps anti-GLE1 est un anticorps Lapin Polyclonal détectant GLE1 dans WB. Adapté pour Humain.

Aperçu rapide pour GLE1 anticorps (ABIN630876)

Antigène: GLE1 (GLE1 RNA Export Mediator (GLE1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLE1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GLE1 anticorps

Purification: Affinity purified

Immunogène: GLE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLE1 Blocking Peptide, (ABIN940475), is also available for use as a blocking control in assays to test for specificity of this GLE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLE1

Antigène: GLE1 (GLE1 RNA Export Mediator (GLE1))

Autre désignation: GLE1

Sujet: GLE1 is a predicted 75 kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes.

Poids moléculaire: 75 kDa (MW of target protein)