TIMM44 anticorps

N° du produit ABIN630889

Cet anticorps Lapin Polyclonal détecte spécifiquement TIMM44 dans WB. Il présente une réactivité avec des échantillons de Humain et Souris.

Aperçu rapide pour TIMM44 anticorps (ABIN630889)

Antigène: TIMM44 (Translocase of Inner Mitochondrial Membrane 44 (TIMM44))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TIMM44 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TIMM44 anticorps

Purification: Affinity purified

Immunogène: TIMM44 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TIMM44 Blocking Peptide, (ABIN5616607), is also available for use as a blocking control in assays to test for specificity of this TIMM44 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIMM44 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TIMM44

Antigène: TIMM44 (Translocase of Inner Mitochondrial Membrane 44 (TIMM44))

Autre désignation: TIMM44

Sujet: TIMM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.

Poids moléculaire: 51 kDa (MW of target protein)