EEF2 anticorps (N-Term)

N° du produit ABIN630891

Cet anticorps anti-EEF2 est un anticorps Lapin Polyclonal détectant EEF2 dans WB. Adapté pour Humain, Souris, Rat, Drosophila melanogaster et C. elegans.

Aperçu rapide pour EEF2 anticorps (N-Term) (ABIN630891)

Antigène: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EEF2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EEF2 anticorps

Épitope: N-Term

Specificité: EEF2 antibody was raised against the N terminal of EEF2

Purification: Affinity purified

Immunogène: EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EEF2 Blocking Peptide, (ABIN5613309), is also available for use as a blocking control in assays to test for specificity of this EEF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EEF2

Antigène: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Autre désignation: EEF2

Sujet: EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Poids moléculaire: 94 kDa (MW of target protein)

Pathways: AMPK Signaling