EEF2 anticorps (N-Term)

N° du produit ABIN630891

Détail du produit anti-EEF2 anticorps

Antigène: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EEF2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EEF2 antibody was raised against the N terminal of EEF2

Purification: Affinity purified

Immunogène: EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EEF2 Blocking Peptide, catalog no. 33R-9020, is also available for use as a blocking control in assays to test for specificity of this EEF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EEF2

Antigène: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Autre désignation: EEF2 (EEF2 Produits)

Synonymes: anticorps EEF-2, anticorps EF-2, anticorps EF2, anticorps Ef-2, anticorps eef2, anticorps MGC76191, anticorps MGC79628, anticorps EEF2, anticorps eef2l, anticorps fe49h02, anticorps wu:fe49h02, anticorps zgc:63584, anticorps ef2, anticorps zef2, anticorps CG2238, anticorps Dmel\CG2238, anticorps EF-2b, anticorps EF2B, anticorps EF2b, anticorps Ef2, anticorps Ef2B, anticorps Ef2b, anticorps anon-EST:Liang-1.44, anticorps chr2L:21668915..21669164, anticorps clone 1.44, anticorps eEF2, anticorps eF2, anticorps ef2b, anticorps eukaryotic translation elongation factor 2, anticorps eukaryotic translation elongation factor 2, gene 1, anticorps eukaryotic translation elongation factor 2b, anticorps Elongation factor 2, anticorps EEF2, anticorps Eef2, anticorps eef2.1, anticorps POSPLDRAFT_118836, anticorps eef2b, anticorps eef-2, anticorps eef2, anticorps EF2

Sujet: EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Poids moléculaire: 94 kDa (MW of target protein)

Pathways: AMPK Signaling