Aquaporin 7 anticorps (C-Term)

N° du produit ABIN630892

Détail du produit anti-Aquaporin 7 anticorps

Antigène: Aquaporin 7 (AQP7)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aquaporin 7 est non-conjugé

Application: Western Blotting (WB)

Specificité: Aquaporin 7 antibody was raised against the C terminal of AQP7

Purification: Affinity purified

Immunogène: Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA

Information d'application

Indications d'application: WB: 0.4 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Aquaporin 7 Blocking Peptide, catalog no. 33R-2182, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Aquaporin 7

Antigène: Aquaporin 7 (AQP7)

Autre désignation: Aquaporin 7 (AQP7 Produits)

Synonymes: anticorps fj98f09, anticorps wu:fj98f09, anticorps zgc:63700, anticorps aqp7l, anticorps aqp9, anticorps aqpap, anticorps AQP7, anticorps AQP7L, anticorps AQP9, anticorps AQPap, anticorps GLYCQTL, anticorps SAQP7, anticorps aquaporin 7, anticorps aqp7, anticorps AQP7, anticorps Aqp7

Sujet: Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.

Poids moléculaire: 37 kDa (MW of target protein)