SCO1 anticorps

N° du produit ABIN630894

Cet anticorps anti-SCO1 est un anticorps Lapin Polyclonal détectant SCO1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SCO1 anticorps (ABIN630894)

Antigène: SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCO1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SCO1 anticorps

Purification: Affinity purified

Immunogène: SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCO1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SCO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCO1

Antigène: SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))

Autre désignation: SCO1

Sujet: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Stem Cell Maintenance, Production of Molecular Mediator of Immune Response, Regulation of long-term Neuronal Synaptic Plasticity