SCO1 anticorps
-
- Antigène Voir toutes SCO1 Anticorps
- SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SCO1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL
- Top Product
- Discover our top product SCO1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SCO1 Blocking Peptide, catalog no. 33R-1346, is also available for use as a blocking control in assays to test for specificity of this SCO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SCO1 (SCO1 Cytochrome C Oxidase Assembly Protein (SCO1))
- Autre désignation
- SCO1 (SCO1 Produits)
- Synonymes
- anticorps SCOD1, anticorps 2610001C07Rik, anticorps D11Bwg1310e, anticorps SCO1, anticorps RGD1559538, anticorps SCO1, cytochrome c oxidase assembly protein, anticorps SCO1 cytochrome c oxidase assembly protein, anticorps SCO1, anticorps Sco1, anticorps sco1
- Sujet
- Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis, Stem Cell Maintenance, Production of Molecular Mediator of Immune Response, Regulation of long-term Neuronal Synaptic Plasticity
-