PGK2 anticorps (C-Term)

N° du produit ABIN630896

L’anticorps Lapin Polyclonal anti-PGK2 a été validé pour WB. Il convient pour détecter PGK2 dans des échantillons de Humain et Souris.

Aperçu rapide pour PGK2 anticorps (C-Term) (ABIN630896)

Antigène: PGK2 (Phosphoglycerate Kinase 2 (PGK2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGK2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PGK2 anticorps

Épitope: C-Term

Specificité: PGK2 antibody was raised against the C terminal of PGK2

Purification: Affinity purified

Immunogène: PGK2 antibody was raised using the C terminal of PGK2 corresponding to a region with amino acids ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGK2 Blocking Peptide, (ABIN939575), is also available for use as a blocking control in assays to test for specificity of this PGK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGK2

Antigène: PGK2 (Phosphoglycerate Kinase 2 (PGK2))

Autre désignation: PGK2

Sujet: PGK2 is a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP.

Poids moléculaire: 46 kDa (MW of target protein)