HSPB8 anticorps (N-Term)

N° du produit ABIN630901

Cet anticorps Lapin Polyclonal détecte spécifiquement HSPB8 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour HSPB8 anticorps (N-Term) (ABIN630901)

Antigène: HSPB8 (Heat Shock 22kDa Protein 8 (HSPB8))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPB8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HSPB8 anticorps

Épitope: N-Term

Specificité: HSPB8 antibody was raised against the N terminal of HSPB8

Purification: Affinity purified

Immunogène: HSPB8 antibody was raised using the N terminal of HSPB8 corresponding to a region with amino acids ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPB8 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HSPB8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPB8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPB8

Antigène: HSPB8 (Heat Shock 22kDa Protein 8 (HSPB8))

Autre désignation: HSPB8

Sujet: HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Poids moléculaire: 21 kDa (MW of target protein)