PPP2R3A anticorps

N° du produit ABIN630911

L’anticorps anti-PPP2R3A Polyclonal Lapin est utilisé pour la détection de PPP2R3A dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PPP2R3A anticorps (ABIN630911)

Antigène: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP2R3A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PPP2R3A anticorps

Purification: Affinity purified

Immunogène: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP2R3A Blocking Peptide, (ABIN5615519), is also available for use as a blocking control in assays to test for specificity of this PPP2R3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP2R3A

Antigène: PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))

Autre désignation: PPP2R3A

Sujet: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division.

Poids moléculaire: 130 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt