PPP2R3A anticorps
-
- Antigène Voir toutes PPP2R3A Anticorps
- PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP2R3A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
- Top Product
- Discover our top product PPP2R3A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP2R3A Blocking Peptide, catalog no. 33R-8853, is also available for use as a blocking control in assays to test for specificity of this PPP2R3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))
- Autre désignation
- PPP2R3A (PPP2R3A Produits)
- Synonymes
- anticorps PPP2R3, anticorps PR130, anticorps PR72, anticorps 3222402P14Rik, anticorps A730042E07, anticorps PPP2R3A, anticorps Ppp2r3a, anticorps protein phosphatase 2 regulatory subunit B''alpha, anticorps protein phosphatase 2, regulatory subunit B'', alpha, anticorps protein phosphatase 2 regulatory subunit B, alpha S homeolog, anticorps serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha, anticorps PPP2R3A, anticorps Ppp2r3a, anticorps ppp2r3a.S, anticorps LOC100088744, anticorps LOC100478108, anticorps ppp2r3a, anticorps LOC100547843, anticorps LOC100729010
- Sujet
- Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division.
- Poids moléculaire
- 130 kDa (MW of target protein)
- Pathways
- Signalisation PI3K-Akt
-