PSME3 anticorps (N-Term)

N° du produit ABIN630917

L’anticorps Lapin Polyclonal anti-PSME3 a été validé pour WB et IHC. Il convient pour détecter PSME3 dans des échantillons de Humain, Rat, Souris et Chien.

Aperçu rapide pour PSME3 anticorps (N-Term) (ABIN630917)

Antigène: PSME3

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSME3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PSME3 anticorps

Épitope: N-Term

Specificité: PSME3 antibody was raised against the N terminal of PSME3

Purification: Affinity purified

Immunogène: PSME3 antibody was raised using the N terminal of PSME3 corresponding to a region with amino acids PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSME3 Blocking Peptide, (ABIN5615638), is also available for use as a blocking control in assays to test for specificity of this PSME3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSME3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSME3

Antigène: PSME3

Autre désignation: PSME3

Sujet: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Positive Regulation of Endopeptidase Activity, Hepatitis C, Synthesis of DNA