PSME3 anticorps (N-Term)

N° du produit ABIN630917

Détail du produit anti-PSME3 anticorps

Antigène: PSME3

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSME3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PSME3 antibody was raised against the N terminal of PSME3

Purification: Affinity purified

Immunogène: PSME3 antibody was raised using the N terminal of PSME3 corresponding to a region with amino acids PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSME3 Blocking Peptide, catalog no. 33R-7157, is also available for use as a blocking control in assays to test for specificity of this PSME3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSME3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSME3

Antigène: PSME3

Autre désignation: PSME3 (PSME3 Produits)

Synonymes: anticorps AA410043, anticorps AU020960, anticorps Ki, anticorps PA28gamma, anticorps REGgamma, anticorps pa28g, anticorps Ab2-371, anticorps PA28-gamma, anticorps PA28G, anticorps REG-GAMMA, anticorps psme3b, anticorps proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki), anticorps proteasome activator subunit 3, anticorps proteasome activator subunit 3 S homeolog, anticorps Psme3, anticorps PSME3, anticorps psme3.S

Sujet: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Positive Regulation of Endopeptidase Activity, Hepatitis C, Synthesis of DNA