GARS anticorps (Middle Region)
-
- Antigène Voir toutes GARS Anticorps
- GARS (Glycyl-tRNA Synthetase (GARS))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GARS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GARS antibody was raised against the middle region of GARS
- Purification
- Affinity purified
- Immunogène
- GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN
- Top Product
- Discover our top product GARS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GARS Blocking Peptide, catalog no. 33R-3949, is also available for use as a blocking control in assays to test for specificity of this GARS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GARS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GARS (Glycyl-tRNA Synthetase (GARS))
- Autre désignation
- GARS (GARS Produits)
- Synonymes
- anticorps CMT2D, anticorps DSMAV, anticorps GlyRS, anticorps HMN5, anticorps SMAD1, anticorps Aat-gly, anticorps CG6778, anticorps Dmel\\CG6778, anticorps GRS, anticorps gars, anticorps team, anticorps RGD1559871, anticorps GENA202, anticorps Gena201, anticorps Nmf249, anticorps Sgrp23, anticorps GB13467, anticorps MGC79495, anticorps fb02f03, anticorps si:dkey-276i5.1, anticorps wu:fb02f03, anticorps NI36_08435, anticorps glycyl-tRNA synthetase, anticorps Glycyl-tRNA synthetase, anticorps glycine--tRNA ligase, anticorps glycyl-tRNA synthetase L homeolog, anticorps Glycine--tRNA ligase, anticorps GARS, anticorps GlyRS, anticorps Gars, anticorps LOC408392, anticorps gars.L, anticorps gars, anticorps LOC692991, anticorps glyQ, anticorps TTHA0543, anticorps NI36_RS08405
- Sujet
- GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.
- Poids moléculaire
- 83 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-