GARS anticorps (Middle Region)

N° du produit ABIN630934

Détail du produit anti-GARS anticorps

Antigène: GARS (Glycyl-tRNA Synthetase (GARS))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GARS est non-conjugé

Application: Western Blotting (WB)

Specificité: GARS antibody was raised against the middle region of GARS

Purification: Affinity purified

Immunogène: GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GARS Blocking Peptide, catalog no. 33R-3949, is also available for use as a blocking control in assays to test for specificity of this GARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GARS

Antigène: GARS (Glycyl-tRNA Synthetase (GARS))

Autre désignation: GARS (GARS Produits)

Synonymes: anticorps CMT2D, anticorps DSMAV, anticorps GlyRS, anticorps HMN5, anticorps SMAD1, anticorps Aat-gly, anticorps CG6778, anticorps Dmel\\CG6778, anticorps GRS, anticorps gars, anticorps team, anticorps RGD1559871, anticorps GENA202, anticorps Gena201, anticorps Nmf249, anticorps Sgrp23, anticorps GB13467, anticorps MGC79495, anticorps fb02f03, anticorps si:dkey-276i5.1, anticorps wu:fb02f03, anticorps NI36_08435, anticorps glycyl-tRNA synthetase, anticorps Glycyl-tRNA synthetase, anticorps glycine--tRNA ligase, anticorps glycyl-tRNA synthetase L homeolog, anticorps Glycine--tRNA ligase, anticorps GARS, anticorps GlyRS, anticorps Gars, anticorps LOC408392, anticorps gars.L, anticorps gars, anticorps LOC692991, anticorps glyQ, anticorps TTHA0543, anticorps NI36_RS08405

Sujet: GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.

Poids moléculaire: 83 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process