LYPLA1 anticorps (Middle Region)

N° du produit ABIN630946

Détail du produit anti-LYPLA1 anticorps

Antigène: LYPLA1 (Lysophospholipase I (LYPLA1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYPLA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYPLA1 antibody was raised against the middle region of LYPLA1

Purification: Affinity purified

Immunogène: LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYPLA1 Blocking Peptide, catalog no. 33R-8940, is also available for use as a blocking control in assays to test for specificity of this LYPLA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYPLA1

Antigène: LYPLA1 (Lysophospholipase I (LYPLA1))

Autre désignation: LYPLA1 (LYPLA1 Produits)

Synonymes: anticorps APT-1, anticorps APT1, anticorps LPL-I, anticorps LPL1, anticorps hAPT1, anticorps Pla1a, anticorps 25KDL, anticorps zgc:110260, anticorps lysophospholipase I, anticorps lysophospholipase 1, anticorps lysophospholipase I L homeolog, anticorps LYPLA1, anticorps Lypla1, anticorps lypla1, anticorps lypla1.L

Sujet: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.

Poids moléculaire: 25 kDa (MW of target protein)