LYPLA1 anticorps (Middle Region)

N° du produit ABIN630946

Cet anticorps Lapin Polyclonal détecte spécifiquement LYPLA1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour LYPLA1 anticorps (Middle Region) (ABIN630946)

Antigène: LYPLA1 (Lysophospholipase I (LYPLA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYPLA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LYPLA1 anticorps

Épitope: Middle Region

Specificité: LYPLA1 antibody was raised against the middle region of LYPLA1

Purification: Affinity purified

Immunogène: LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYPLA1 Blocking Peptide, (ABIN5614613), is also available for use as a blocking control in assays to test for specificity of this LYPLA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYPLA1

Antigène: LYPLA1 (Lysophospholipase I (LYPLA1))

Autre désignation: LYPLA1

Sujet: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.

Poids moléculaire: 25 kDa (MW of target protein)