FBLN3 anticorps (Middle Region)

N° du produit ABIN630948

Cet anticorps anti-FBLN3 Polyclonal Lapin (ABIN630948) détecte spécifiquement FBLN3 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour FBLN3 anticorps (Middle Region) (ABIN630948)

Antigène: FBLN3 (Fibulin 3 (FBLN3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBLN3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBLN3 anticorps

Épitope: Middle Region

Specificité: EFEMP1 antibody was raised against the middle region of EFEMP1

Purification: Affinity purified

Immunogène: EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EFEMP1 Blocking Peptide, (ABIN5613311), is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBLN3

Antigène: FBLN3 (Fibulin 3 (FBLN3))

Autre désignation: EFEMP1

Sujet: EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway