PTGDS anticorps (N-Term)

N° du produit ABIN630956

Détail du produit anti-PTGDS anticorps

Antigène: PTGDS (Prostaglandin D2 Synthase (PTGDS))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTGDS est non-conjugé

Application: Western Blotting (WB)

Specificité: PGDS antibody was raised against the N terminal of PGDS

Purification: Affinity purified

Immunogène: PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGDS Blocking Peptide, catalog no. 33R-2657, is also available for use as a blocking control in assays to test for specificity of this PGDS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTGDS

Antigène: PTGDS (Prostaglandin D2 Synthase (PTGDS))

Autre désignation: PGDS (PTGDS Produits)

Synonymes: anticorps 6PGD, anticorps GSTS, anticorps GSTS1-1, anticorps PGD2, anticorps PGDS, anticorps L-PGDS, anticorps LPGDS, anticorps PDS, anticorps PGDS2, anticorps H-PGDS, anticorps Ptgds2, anticorps 21kDa, anticorps Ptgs3, anticorps PH2DISO, anticorps phosphogluconate dehydrogenase, anticorps hematopoietic prostaglandin D synthase, anticorps prostaglandin D2 synthase, anticorps prostaglandin D2 synthase (brain), anticorps prostaglandin D synthase, anticorps prostaglandin D2 synthase 21kDa (brain), anticorps PGD, anticorps HPGDS, anticorps PTGDS, anticorps Hpgds, anticorps Ptgds, anticorps LOC100009453

Sujet: PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.

Poids moléculaire: 23 kDa (MW of target protein)