PTGDS anticorps (N-Term)
-
- Antigène Voir toutes PTGDS Anticorps
- PTGDS (Prostaglandin D2 Synthase (PTGDS))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTGDS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PGDS antibody was raised against the N terminal of PGDS
- Purification
- Affinity purified
- Immunogène
- PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME
- Top Product
- Discover our top product PTGDS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGDS Blocking Peptide, catalog no. 33R-2657, is also available for use as a blocking control in assays to test for specificity of this PGDS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGDS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTGDS (Prostaglandin D2 Synthase (PTGDS))
- Autre désignation
- PGDS (PTGDS Produits)
- Synonymes
- anticorps 6PGD, anticorps GSTS, anticorps GSTS1-1, anticorps PGD2, anticorps PGDS, anticorps L-PGDS, anticorps LPGDS, anticorps PDS, anticorps PGDS2, anticorps H-PGDS, anticorps Ptgds2, anticorps 21kDa, anticorps Ptgs3, anticorps PH2DISO, anticorps phosphogluconate dehydrogenase, anticorps hematopoietic prostaglandin D synthase, anticorps prostaglandin D2 synthase, anticorps prostaglandin D2 synthase (brain), anticorps prostaglandin D synthase, anticorps prostaglandin D2 synthase 21kDa (brain), anticorps PGD, anticorps HPGDS, anticorps PTGDS, anticorps Hpgds, anticorps Ptgds, anticorps LOC100009453
- Sujet
- PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
- Poids moléculaire
- 23 kDa (MW of target protein)
-