ACTRT2 anticorps (C-Term)

N° du produit ABIN630957

Cet anticorps anti-ACTRT2 est un anticorps Lapin Polyclonal détectant ACTRT2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ACTRT2 anticorps (C-Term) (ABIN630957)

Antigène: ACTRT2 (Actin-Related Protein T2 (ACTRT2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTRT2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACTRT2 anticorps

Épitope: C-Term

Specificité: ACTRT2 antibody was raised against the C terminal of ACTRT2

Purification: Affinity purified

Immunogène: ACTRT2 antibody was raised using the C terminal of ACTRT2 corresponding to a region with amino acids LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTRT2 Blocking Peptide, (ABIN940228), is also available for use as a blocking control in assays to test for specificity of this ACTRT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTRT2

Antigène: ACTRT2 (Actin-Related Protein T2 (ACTRT2))

Autre désignation: ACTRT2

Sujet: ACTRT2 belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.

Poids moléculaire: 42 kDa (MW of target protein)