ACTRT2 anticorps (C-Term)

N° du produit ABIN630957

Détail du produit anti-ACTRT2 anticorps

Antigène: ACTRT2 (Actin-Related Protein T2 (ACTRT2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTRT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACTRT2 antibody was raised against the C terminal of ACTRT2

Purification: Affinity purified

Immunogène: ACTRT2 antibody was raised using the C terminal of ACTRT2 corresponding to a region with amino acids LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTRT2 Blocking Peptide, catalog no. 33R-4842, is also available for use as a blocking control in assays to test for specificity of this ACTRT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTRT2

Antigène: ACTRT2 (Actin-Related Protein T2 (ACTRT2))

Autre désignation: ACTRT2 (ACTRT2 Produits)

Synonymes: anticorps ARPM2, anticorps ARPT2, anticorps Arp-T2, anticorps HARPM2, anticorps 1700052K15Rik, anticorps Arpm2, anticorps actin related protein T2, anticorps actin-related protein T2, anticorps ACTRT2, anticorps Actrt2

Sujet: ACTRT2 belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.

Poids moléculaire: 42 kDa (MW of target protein)