DPPA2 anticorps (N-Term)

N° du produit ABIN630962

Détail du produit anti-DPPA2 anticorps

Antigène: DPPA2 (Developmental Pluripotency Associated 2 (DPPA2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPPA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DPPA2 antibody was raised against the N terminal of DPPA2

Purification: Affinity purified

Immunogène: DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPPA2 Blocking Peptide, catalog no. 33R-6792, is also available for use as a blocking control in assays to test for specificity of this DPPA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPPA2

Antigène: DPPA2 (Developmental Pluripotency Associated 2 (DPPA2))

Autre désignation: DPPA2 (DPPA2 Produits)

Synonymes: anticorps 2410088E07Rik, anticorps C80932, anticorps D19Mgi18, anticorps ECAT15-2, anticorps CT100, anticorps PESCRG1, anticorps developmental pluripotency associated 2, anticorps ABC-type oliopeptide/dipeptide transporter, periplasmic binding protein DppA, anticorps Dppa2, anticorps DPPA2, anticorps dppA2

Sujet: DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Stem Cell Maintenance