Adenylate Kinase 1 anticorps (Middle Region)

N° du produit ABIN630970

Détail du produit anti-Adenylate Kinase 1 anticorps

Antigène: Adenylate Kinase 1 (AK1)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adenylate Kinase 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: AK1 antibody was raised against the middle region of AK1

Purification: Affinity purified

Immunogène: AK1 antibody was raised using the middle region of AK1 corresponding to a region with amino acids RIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AK1 Blocking Peptide, catalog no. 33R-7966, is also available for use as a blocking control in assays to test for specificity of this AK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Adenylate Kinase 1

Antigène: Adenylate Kinase 1 (AK1)

Autre désignation: AK1 (AK1 Produits)

Synonymes: anticorps ADK-1, anticorps AK1, anticorps CG17146, anticorps DAK1, anticorps Dak1, anticorps Dmel\\CG17146, anticorps adk1, anticorps bs34e10.y1, anticorps ak5, anticorps ADENYLATE KINASE 1, anticorps MLE2.3, anticorps MLE2_3, anticorps adenylate kinase 1, anticorps Ak-1, anticorps B430205N08Rik, anticorps Ak 1, anticorps zgc:91930, anticorps Myokinase, anticorps Adenylate kinase 1, anticorps adenylate kinase 1, anticorps Adk1, anticorps ak1, anticorps AK1, anticorps ADK1, anticorps Ak1

Sujet: Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process