WBP11 anticorps (N-Term)
-
- Antigène Voir toutes WBP11 Anticorps
- WBP11 (WW Domain Binding Protein 11 (WBP11))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WBP11 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WBP11 antibody was raised against the N terminal of WBP11
- Purification
- Affinity purified
- Immunogène
- WBP11 antibody was raised using the N terminal of WBP11 corresponding to a region with amino acids GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK
- Top Product
- Discover our top product WBP11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WBP11 Blocking Peptide, catalog no. 33R-3541, is also available for use as a blocking control in assays to test for specificity of this WBP11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WBP11 (WW Domain Binding Protein 11 (WBP11))
- Autre désignation
- WBP11 (WBP11 Produits)
- Sujet
- WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.
- Poids moléculaire
- 70 kDa (MW of target protein)
-