Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

MRPL39 anticorps (Mitochondrial Ribosomal Protein L39) (N-Term) Primary Antibody

MRPL39 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN630985
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Destination: Etats-Unis
Envoi sous 9 à 11 jours ouvrables
  • Antigène
    MRPL39
    Épitope
    N-Term
    • 12
    • 8
    • 7
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivité
    Humain
    • 45
    • 24
    • 20
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Conjugué
    Cet anticorp MRPL39 est non-conjugé
    • 17
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 33
    • 21
    • 13
    • 9
    • 4
    • 1
    • 1
    • 1
    Specificité
    MRPL39 antibody was raised against the N terminal of MRPL39
    Purification
    Affinity purified
    Immunogène
    MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    MRPL39 Blocking Peptide, catalog no. 33R-9047, is also available for use as a blocking control in assays to test for specificity of this MRPL39 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL39 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    MRPL39
    Autre désignation
    MRPL39 (MRPL39 Antibody Extrait)
    Synonymes
    CG17166, Dmel\\CG17166, MRP-L5, mRpL5, C21orf92, L39mt, MRPL5, PRED22, PRED66, RPML5, C21orf8, ORF22, Rpml5, mitochondrial ribosomal protein L39, mitochondrial ribosomal protein L39 L homeolog, mRpL39, mrpl39.L, MRPL39, Mrpl39
    Sujet
    Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.
    Poids moléculaire
    39 kDa (MW of target protein)
Vous êtes ici:
help Support technique