MRPL39 anticorps (N-Term)

N° du produit ABIN630985

Détail du produit anti-MRPL39 anticorps

Antigène: MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL39 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPL39 antibody was raised against the N terminal of MRPL39

Purification: Affinity purified

Immunogène: MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL39 Blocking Peptide, catalog no. 33R-9047, is also available for use as a blocking control in assays to test for specificity of this MRPL39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL39

Antigène: MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))

Autre désignation: MRPL39 (MRPL39 Produits)

Synonymes: anticorps CG17166, anticorps Dmel\\CG17166, anticorps MRP-L5, anticorps mRpL5, anticorps C21orf92, anticorps L39mt, anticorps MRPL5, anticorps PRED22, anticorps PRED66, anticorps RPML5, anticorps C21orf8, anticorps ORF22, anticorps Rpml5, anticorps mitochondrial ribosomal protein L39, anticorps mitochondrial ribosomal protein L39 L homeolog, anticorps mRpL39, anticorps mrpl39.L, anticorps MRPL39, anticorps Mrpl39

Sujet: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

Poids moléculaire: 39 kDa (MW of target protein)