OXSM anticorps (Middle Region)

N° du produit ABIN630986

Détail du produit anti-OXSM anticorps

Antigène: OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OXSM est non-conjugé

Application: Western Blotting (WB)

Specificité: OXSM antibody was raised against the middle region of OXSM

Purification: Affinity purified

Immunogène: OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OXSM Blocking Peptide, catalog no. 33R-3696, is also available for use as a blocking control in assays to test for specificity of this OXSM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXSM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OXSM

Antigène: OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))

Autre désignation: OXSM (OXSM Produits)

Synonymes: anticorps FASN2D, anticorps KASI, anticorps KS, anticorps 4933425A18Rik, anticorps C80494, anticorps RGD1311092, anticorps fatty acid synthase, anticorps 3-oxoacyl-ACP synthase, mitochondrial, anticorps FASN, anticorps OXSM, anticorps oxsm, anticorps Oxsm

Sujet: OXSM is a mitochondrial beta-ketoacyl synthase (EC 2.3.1.41) involved in mitochondrial fatty acid synthesis. It is required for catalysis of the chain-elongating condensation reaction.

Poids moléculaire: 49 kDa (MW of target protein)