WBP2NL anticorps (N-Term)

N° du produit ABIN630989

Détail du produit anti-WBP2NL anticorps

Antigène: WBP2NL (WBP2 N-terminal Like (WBP2NL))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WBP2NL est non-conjugé

Application: Western Blotting (WB)

Specificité: WBP2 NL antibody was raised against the N terminal of WBP2 L

Purification: Affinity purified

Immunogène: WBP2 NL antibody was raised using the N terminal of WBP2 L corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WBP2NL Blocking Peptide, catalog no. 33R-5799, is also available for use as a blocking control in assays to test for specificity of this WBP2NL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP0 L antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WBP2NL

Antigène: WBP2NL (WBP2 N-terminal Like (WBP2NL))

Autre désignation: WBP2NL (WBP2NL Produits)

Synonymes: anticorps pawp, anticorps PAWP, anticorps 4930521I23Rik, anticorps WBP2 N-terminal like, anticorps WBP2 N-terminal like L homeolog, anticorps Wbp2nl, anticorps wbp2nl.L, anticorps wbp2nl, anticorps WBP2NL

Sujet: WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.

Poids moléculaire: 32 kDa (MW of target protein)