WBP2NL anticorps (N-Term)
-
- Antigène Voir toutes WBP2NL Anticorps
- WBP2NL (WBP2 N-terminal Like (WBP2NL))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WBP2NL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WBP2 NL antibody was raised against the N terminal of WBP2 L
- Purification
- Affinity purified
- Immunogène
- WBP2 NL antibody was raised using the N terminal of WBP2 L corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT
- Top Product
- Discover our top product WBP2NL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WBP2NL Blocking Peptide, catalog no. 33R-5799, is also available for use as a blocking control in assays to test for specificity of this WBP2NL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP0 L antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WBP2NL (WBP2 N-terminal Like (WBP2NL))
- Autre désignation
- WBP2NL (WBP2NL Produits)
- Synonymes
- anticorps pawp, anticorps PAWP, anticorps 4930521I23Rik, anticorps WBP2 N-terminal like, anticorps WBP2 N-terminal like L homeolog, anticorps Wbp2nl, anticorps wbp2nl.L, anticorps wbp2nl, anticorps WBP2NL
- Sujet
- WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.
- Poids moléculaire
- 32 kDa (MW of target protein)
-