AK4 anticorps (N-Term)
-
- Antigène Voir toutes AK4 Anticorps
- AK4 (Adenylate Kinase 4 (AK4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AK4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AK3 L1 antibody was raised against the N terminal of AK3 1
- Purification
- Affinity purified
- Immunogène
- AK3 L1 antibody was raised using the N terminal of AK3 1 corresponding to a region with amino acids MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEV
- Top Product
- Discover our top product AK4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AK3L1 Blocking Peptide, catalog no. 33R-5749, is also available for use as a blocking control in assays to test for specificity of this AK3L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AK4 (Adenylate Kinase 4 (AK4))
- Autre désignation
- AK3L1 (AK4 Produits)
- Synonymes
- anticorps AK 4, anticorps AK3, anticorps AK3L1, anticorps AK3L2, anticorps ak3l1, anticorps wu:fc37g02, anticorps zgc:85790, anticorps AK4, anticorps Ak-3, anticorps Ak-4, anticorps Ak3, anticorps Ak3l1, anticorps D4Ertd274e, anticorps Ak3l2, anticorps adenylate kinase 4, anticorps AK4, anticorps ak4, anticorps Ak4, anticorps ADK4
- Sujet
- AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-