AK4 anticorps (N-Term)

N° du produit ABIN631000

Détail du produit anti-AK4 anticorps

Antigène: AK4 (Adenylate Kinase 4 (AK4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AK4 est non-conjugé

Application: Western Blotting (WB)

Specificité: AK3 L1 antibody was raised against the N terminal of AK3 1

Purification: Affinity purified

Immunogène: AK3 L1 antibody was raised using the N terminal of AK3 1 corresponding to a region with amino acids MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AK3L1 Blocking Peptide, catalog no. 33R-5749, is also available for use as a blocking control in assays to test for specificity of this AK3L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AK4

Antigène: AK4 (Adenylate Kinase 4 (AK4))

Autre désignation: AK3L1 (AK4 Produits)

Synonymes: anticorps AK 4, anticorps AK3, anticorps AK3L1, anticorps AK3L2, anticorps ak3l1, anticorps wu:fc37g02, anticorps zgc:85790, anticorps AK4, anticorps Ak-3, anticorps Ak-4, anticorps Ak3, anticorps Ak3l1, anticorps D4Ertd274e, anticorps Ak3l2, anticorps adenylate kinase 4, anticorps AK4, anticorps ak4, anticorps Ak4, anticorps ADK4

Sujet: AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process