Coilin anticorps (C-Term)

N° du produit ABIN631002

Cet anticorps anti-Coilin est un anticorps Lapin Polyclonal détectant Coilin dans WB. Adapté pour Humain.

Aperçu rapide pour Coilin anticorps (C-Term) (ABIN631002)

Antigène: Coilin (COIL)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Coilin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Coilin anticorps

Épitope: C-Term

Specificité: Coilin antibody was raised against the C terminal of COIL

Purification: Affinity purified

Immunogène: Coilin antibody was raised using the C terminal of COIL corresponding to a region with amino acids DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Coilin Blocking Peptide, (ABIN937633), is also available for use as a blocking control in assays to test for specificity of this Coilin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COIL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Coilin

Antigène: Coilin (COIL)

Autre désignation: Coilin

Sujet: COIL is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization