Coilin anticorps (C-Term)

N° du produit ABIN631002

Détail du produit anti-Coilin anticorps

Antigène: Coilin (COIL)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Coilin est non-conjugé

Application: Western Blotting (WB)

Specificité: Coilin antibody was raised against the C terminal of COIL

Purification: Affinity purified

Immunogène: Coilin antibody was raised using the C terminal of COIL corresponding to a region with amino acids DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Coilin Blocking Peptide, catalog no. 33R-2247, is also available for use as a blocking control in assays to test for specificity of this Coilin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COIL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Coilin

Antigène: Coilin (COIL)

Autre désignation: Coilin (COIL Produits)

Synonymes: anticorps p80c, anticorps coil, anticorps CG8710, anticorps Coilin, anticorps Dmel\\CG8710, anticorps LOC100218802, anticorps F3F19.5, anticorps F3F19_5, anticorps CLN80, anticorps p80-coilin, anticorps C79982, anticorps Cln80, anticorps p80, anticorps wu:fb08h11, anticorps sph1, anticorps Coilin, anticorps coilin, anticorps sphere organelles protein-like protein, anticorps coilin p80, anticorps coilin L homeolog, anticorps p80c, anticorps COIL, anticorps coil, anticorps AT1G13030, anticorps Coil, anticorps coil.L

Sujet: COIL is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization