TXN2 anticorps (Middle Region)

N° du produit ABIN631006

Cet anticorps Lapin Polyclonal détecte spécifiquement TXN2 dans WB. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour TXN2 anticorps (Middle Region) (ABIN631006)

Antigène: TXN2 (Thioredoxin 2 (TXN2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TXN2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TXN2 anticorps

Épitope: Middle Region

Specificité: Thioredoxin 2 antibody was raised against the middle region of TXN2

Purification: Affinity purified

Immunogène: Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Thioredoxin 2 Blocking Peptide, (ABIN5616586), is also available for use as a blocking control in assays to test for specificity of this Thioredoxin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TXN2

Antigène: TXN2 (Thioredoxin 2 (TXN2))

Autre désignation: Thioredoxin 2

Sujet: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.

Poids moléculaire: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis