TST anticorps

N° du produit ABIN631012

Cet anticorps Lapin Polyclonal détecte spécifiquement TST dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour TST anticorps (ABIN631012)

Antigène: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TST est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TST anticorps

Purification: Affinity purified

Immunogène: TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TST Blocking Peptide, (ABIN938615), is also available for use as a blocking control in assays to test for specificity of this TST antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TST

Antigène: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Autre désignation: TST

Sujet: TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Poids moléculaire: 33 kDa (MW of target protein)