TST anticorps

N° du produit ABIN631012

Cet anticorps Lapin Polyclonal détecte spécifiquement TST dans WB et IHC. Il présente une réactivité avec des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour TST anticorps (ABIN631012)

Antigène: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TST est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TST anticorps

Purification: Affinity purified

Immunogène: TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TST Blocking Peptide, (ABIN938615), is also available for use as a blocking control in assays to test for specificity of this TST antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TST

Antigène: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Autre désignation: TST

Sujet: TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Poids moléculaire: 33 kDa (MW of target protein)