TST anticorps

N° du produit ABIN631012

Détail du produit anti-TST anticorps

Antigène: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TST est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TST Blocking Peptide, catalog no. 33R-3229, is also available for use as a blocking control in assays to test for specificity of this TST antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TST

Antigène: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Autre désignation: TST (TST Produits)

Synonymes: anticorps RDS, anticorps cysA, anticorps SCD66.01, anticorps SCD84.31, anticorps An12g01520, anticorps SPCP25A2.01c, anticorps AO090010000212, anticorps Rhodanese, anticorps RHODAN, anticorps thiosulfate sulfurtransferase, anticorps thiosulfate sulfurtransferase, involved in tRNA wobble position thiolation Tum1 (predicted), anticorps Thiosulfate sulfurtransferase, anticorps thiosulfate sulfurtransferase, mitochondrial, anticorps TST, anticorps SCO4164, anticorps CND03690, anticorps ANI_1_218104, anticorps tum1, anticorps AOR_1_380024, anticorps Deipr_0023, anticorps Marky_1331, anticorps Tst

Sujet: TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Poids moléculaire: 33 kDa (MW of target protein)