LACTB anticorps (C-Term)

N° du produit ABIN631015

Cet anticorps Lapin Polyclonal détecte spécifiquement LACTB dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour LACTB anticorps (C-Term) (ABIN631015)

Antigène: LACTB (Lactamase, beta (LACTB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LACTB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LACTB anticorps

Épitope: C-Term

Specificité: Beta Lactamase antibody was raised against the C terminal of LACTB

Purification: Affinity purified

Immunogène: Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Beta Lactamase Blocking Peptide, (ABIN5612321), is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LACTB

Antigène: LACTB (Lactamase, beta (LACTB))

Autre désignation: beta Lactamase

Sujet: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Poids moléculaire: 61 kDa (MW of target protein)