MRPL10 anticorps (N-Term)

N° du produit ABIN631016

Détail du produit anti-MRPL10 anticorps

Antigène: MRPL10 (Mitochondrial Ribosomal Protein L10 (MRPL10))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL10 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPL10 antibody was raised against the N terminal of MRPL10

Purification: Affinity purified

Immunogène: MRPL10 antibody was raised using the N terminal of MRPL10 corresponding to a region with amino acids HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL10 Blocking Peptide, catalog no. 33R-3847, is also available for use as a blocking control in assays to test for specificity of this MRPL10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL10

Antigène: MRPL10 (Mitochondrial Ribosomal Protein L10 (MRPL10))

Autre désignation: MRPL10 (MRPL10 Produits)

Synonymes: anticorps CG11488, anticorps Dmel\\CG11488, anticorps L10, anticorps 0610040E02Rik, anticorps C78440, anticorps MRP-L8, anticorps Rpml8, anticorps L10MT, anticorps MRP-L10, anticorps MRPL8, anticorps RPML8, anticorps L10mt, anticorps zgc:112529, anticorps MRPL18, anticorps mitochondrial ribosomal protein L10, anticorps mitochondrial ribosomal protein L10 S homeolog, anticorps mitochondrial 54S ribosomal protein YmL10/YmL18, anticorps mitochondrial ribosomal protein subunit L15 (predicted), anticorps mRpL10, anticorps Mrpl10, anticorps MRPL10, anticorps mrpl10.S, anticorps mrpl10

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q.

Poids moléculaire: 29 kDa (MW of target protein)